PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim01g091630.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 822aa    MW: 89849.9 Da    PI: 6.2812
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim01g091630.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.85.8e-21126181156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t++q++eLe+lF+++++p++++r eL+k+l+L++rqVk+WFqNrR+++k
  Sopim01g091630.0.1 126 KKRYHRHTPQQIQELESLFKECPHPDEKQRLELSKRLSLETRQVKFWFQNRRTQMK 181
                         688999***********************************************999 PP

2START198.53e-623335571206
                         HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
               START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                         ela++a++elvk+a+ +ep+W++s     e++n +e++++f++  +     + +ea+r++g+v+ ++  lve+l+d++ +W e+++    +
  Sopim01g091630.0.1 333 ELALAAMEELVKMAQTDEPLWFRSIeggrEILNHEEYIRTFTPCIGmrpnsFISEASRETGMVIINSLALVETLMDSN-KWAEMFPcliaR 422
                         5899**************************************9999********************************.************ PP

                         EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEE CS
               START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghs 162
                          +t++vissg      galqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+d  ++ +  + +  +++lpSg+++++++ng+s
  Sopim01g091630.0.1 423 TSTTDVISSGmggtrnGALQLMHAELQVLSPLVPiREVNFLRFCKQHAEGVWAVVDVSIDTIRETSGAPTFPNSRRLPSGCVVQDMPNGYS 513
                         ****************************************************************999************************ PP

                         EEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 163 kvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         kvtwveh+++++   h l+r+l++ g+ +ga++wvatlqrqce+
  Sopim01g091630.0.1 514 KVTWVEHAEYEEGANHHLYRQLISAGMGFGAQRWVATLQRQCEC 557
                         ******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-21112177IPR009057Homeodomain-like
SuperFamilySSF466891.67E-20113183IPR009057Homeodomain-like
PROSITE profilePS5007117.637123183IPR001356Homeobox domain
SMARTSM003895.2E-19124187IPR001356Homeobox domain
CDDcd000865.34E-19125183No hitNo description
PfamPF000461.7E-18126181IPR001356Homeobox domain
PROSITE patternPS000270158181IPR017970Homeobox, conserved site
PROSITE profilePS5084843.74324560IPR002913START domain
SuperFamilySSF559613.3E-31326557No hitNo description
CDDcd088751.78E-122328556No hitNo description
SMARTSM002345.5E-48333557IPR002913START domain
PfamPF018526.9E-54333557IPR002913START domain
SuperFamilySSF559611.19E-23576807No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 822 aa     Download sequence    Send to blast
MNFGGFLDNN SGGGGARIVA DIPFNHNNSS SNNDNKNNMP TGAISQPRLL PQSLAKNMFN  60
SPGLSLALQT GMEGQSEVTR MAENYEGNNS VGRRSREEEP DSRSGSDNLE GASGDEQDAT  120
DKPPRKKRYH RHTPQQIQEL ESLFKECPHP DEKQRLELSK RLSLETRQVK FWFQNRRTQM  180
KTQLERHENS ILRQENDKLR AENMSIREAM RNPICTNCGG PAMIGEISLE EQHLRIENAR  240
LKDELDRVCA LAGKFLGRPI SSLVTSMPPP MPNSSLELGV GSNGFGGMSN VPTTLPLAPP  300
DFGVGISNSL PVVPSTRQST GIERSLERSM YLELALAAME ELVKMAQTDE PLWFRSIEGG  360
REILNHEEYI RTFTPCIGMR PNSFISEASR ETGMVIINSL ALVETLMDSN KWAEMFPCLI  420
ARTSTTDVIS SGMGGTRNGA LQLMHAELQV LSPLVPIREV NFLRFCKQHA EGVWAVVDVS  480
IDTIRETSGA PTFPNSRRLP SGCVVQDMPN GYSKVTWVEH AEYEEGANHH LYRQLISAGM  540
GFGAQRWVAT LQRQCECLAI LMSSTVSARD HTAITPSGRR SMLKLAQRMT NNFCAGVCAS  600
TVHKWNKLCA GNVDEDVRVM TRKSVDDPGE PAGIVLSAAT SVWLPVSPQR LFDFLRDERL  660
RSEWDILSNG GPMQEMAHIA KGQDHGNCVS LLRASAMNAN QSSMLILQET CIDAAGALVV  720
YAPVDIPAMH VVMNGGDSAY VALLPSGFSI VPDGPGSRGS NGPSCNGGPD QRISGSLLTV  780
AFQILVNSLP TAKLTVESVE TVNNLISCTV QKIKAALQCE S*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ2221850.0GQ222185.1 Solanum lycopersicum cultivar M82 cutin deficient 2 (CD2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234657.20.0cutin deficient 2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLK4AZA30.0K4AZA3_SOLLC; Uncharacterized protein
STRINGSolyc01g091630.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16262465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein